.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fyk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3. To be Published
    Site RSGI
    PDB Id 2fyk Target Id pho001000147.2
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13776, Molecular Weight 26070.16 Da.
    Residues 235 Isoelectric Point 8.96
    Sequence mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespegglwlsivlspk vpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegkgdkivlgiglnvnnkvpn gatsmklelgsevpllsvfrslitnldrlylnflknpmdilnlvrdnmilgvrvkilgdgsfegiaedi ddfgrliirldsgevkkviygdvslrfl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.214
    Matthews' coefficent 2.14 Rfactor 0.199
    Waters 618 Solvent Content 42.49

    Ligand Information
    Ligands ADP (ADENOSINE-5'-DIPHOSPHATE) x 2;BTN (BIOTIN) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch