.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gs9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TT1324 from Thermus thermophilis HB8. To be Published
    Site RSGI
    PDB Id 2gs9 Target Id ttk003001324.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14683, Molecular Weight 23359.52 Da.
    Residues 212 Isoelectric Point 5.09
    Sequence mdpfaslaeayeawygtplgayviaeeeralkgllppgesllevgagtgywlrrlpypqkvgvepseam lavgrrrapeatwvrawgealpfpgesfdvvllfttlefvedvervllearrvlrpggalvvgvleals pwaalyrrlgekgvlpwaqarflaredlkallgppeaegeavflapeahppyeeadlagrragnrpaly lgrwr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.60 Rfree 0.239
    Matthews' coefficent 5.66 Rfactor 0.215
    Waters 63 Solvent Content 78.27

    Ligand Information
    Ligands SAH (S-ADENOSYL-L-HOMOCYSTEINE) x 2;FMT (FORMIC) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch