The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of activated CRP protein from E coli. To be Published
    Site RSGI
    PDB Id 2gzw Target Id eco001003695.1
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS12271, Molecular Weight 22729.12 Da.
    Residues 202 Isoelectric Point 6.96
    Sequence tdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqgdfigelgl feegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvtsekvgnlafldvtgria qtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlisahgktivvygt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.21 Rfree 0.278
    Matthews' coefficent 2.37 Rfactor 0.224
    Waters 379 Solvent Content 48.05

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch