.
The Open Protein Structure Annotation Network
PDB Keyword
.

2h09

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the manganese transport regulatory protein from Escherichia coli. Proteins 2009
    Site RSGI
    PDB Id 2h09 Target Id eco002000801.1
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS12275, Molecular Weight 17639.37 Da.
    Residues 155 Isoelectric Point 6.32
    Sequence msrragtptakkvtqlvnveehvegfrqvreahrreliddyvelisdlirevgearqvdmaarlgvsqp tvakmlkrlatmgliemipwrgvfltaegeklaqesrerhqivenfllvlgvspeiarrdaegmehhvs eetldafrlftqkhgak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.258
    Matthews' coefficent 1.96 Rfactor 0.238
    Waters 78 Solvent Content 37.22

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch