The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TTHA0807, a CcpA regulator, from Thermus thermophilus HB8. Proteins 2009
    Site RSGI
    PDB Id 2h0a Target Id ttk003001016.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14507, Molecular Weight 28656.30 Da.
    Residues 255 Isoelectric Point 9.57
    Sequence mkrkkptihdvaakagvglgtvsrvlndhpavrhetrarvlrameelgyapnpharriaggrsytvsvl lpfvatefyrrlvegiegvlleqrydlalfpilslarlkrylenttlayltdglilasydlterfeegr lpterpvvlvdaqnprydsvyldnrlggrlagaylarfpgpifaiaveeepdrafrrtvfaermagfqe alkeagrpfspdrlyitrhsqeggrlalrhflekaspplnvfagadqv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.80 Rfree 0.268
    Matthews' coefficent 3.13 Rfactor 0.224
    Waters 185 Solvent Content 60.71

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch