.
The Open Protein Structure Annotation Network
PDB Keyword
.

2how

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Dipeptidase (PH0974) from Pyrococcus Horikoshii Ot3. To be Published
    Site RSGI
    PDB Id 2how Target Id pho001000974.2
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13956, Molecular Weight 40173.13 Da.
    Residues 356 Isoelectric Point 5.40
    Sequence mrlekfihllgergfdgalispgtnlyyltglrlhevgerlailavsaegdyrflapslyenvvnnfpa tfwhdgenpyaklreileelgiskgriliedtmradwligimklgkftfqplsslikelrmikdkeevk mmehasriadkvfeeiltwdligmkerelalkiellirelsdgiafepivasgenaanphhepgerkir kgdiiildygarwkgycsditrtiglgelderlvkiyevvkdaqesafkavregikakdvdsrarevis kagygeyfihrtghglgldvheepyigpdgevilkngmtftiepgiyvpglggvrieddivvdegkgrr ltkaereliil
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.265
    Matthews' coefficent 2.36 Rfactor 0.21
    Waters 310 Solvent Content 47.82

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch