The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TTHA0676 from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2htm Target Id ttk003000283.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14319, Molecular Weight 28447.53 Da.
    Residues 268 Isoelectric Point 5.89
    Sequence mdtwkvgpvelksrlilgsgkyedfgvmreaiaaakaevvtvsvrrvelkapghvgllealegvrllpn tagartaeeavrlarlgrlltgerwvklevipdptyllpdpletlkaaerlieedflvlpymgpdlvla krlaalgtatvmplaapigsgwgvrtrallelfarekaslppvvvdaglglpshaaevmelgldavlvn taiaeaqdppamaeafrlaveagrkaylagpmrpreaaspsspvegvpftptgprpgrgpq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.30 Rfree 0.266
    Matthews' coefficent 2.24 Rfactor 0.253
    Waters 359 Solvent Content 45.05

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch