.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hvb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein PH1083 from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2hvb Target Id pho001001083.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13972, Molecular Weight 14327.75 Da.
    Residues 124 Isoelectric Point 6.30
    Sequence mhhkakvigmlketirsgdwkgekhvpvieyeregdlvkvevsvgkeiphpntpehhiawielyfhpeg gqfpilvgrveftnhsdpltepravfffktskkgklyalsycnihglwenevqle
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.50 Rfree 0.218
    Matthews' coefficent 2.27 Rfactor 0.208
    Waters 187 Solvent Content 45.74

    Ligand Information
    Ligands
    Metals FE (FE) x 4

    Jmol

     

    Protein Summary

    Please see

    2amu

    entry.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch