.
The Open Protein Structure Annotation Network
PDB Keyword
.

2iex

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of dihydroxynapthoic acid synthetase (GK2873) from Geobacillus kaustophilus HTA426. To be Published
    Site RSGI
    PDB Id 2iex Target Id gka001002873.1
    Molecular Characteristics
    Source Geobacillus kaustophilus
    Alias Ids TPS12315, Molecular Weight 30296.07 Da.
    Residues 274 Isoelectric Point 6.12
    Sequence ghmpfewvkqydyediiyetyngiakitinrpevhnafrpktvnemidaftkarddsnigviiltgagg kafcsggdqkvrghggyvgedeiprlnvldlqrlirvipkpviamvagyaiggghvlhvvcdltiaadn aifgqtgpkvgsfdggygagylarivghkkareiwylcrqytaqealemglvnkvvpleqleeetvkwa qeileksptairflkaafnadsdglagiqqlagdatllfytteeakegmrafkekrkpdfsqfprfp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.20 Rfree 0.23
    Matthews' coefficent 1.83 Rfactor 0.18
    Waters 726 Solvent Content 32.83

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch