.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ipc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Translocation ATPase SecA from Thermus thermophilus Reveals a Parallel, Head-to-Head Dimer. J.Mol.Biol. 364 248-258 2006
    Site RSGI
    PDB Id 2ipc Target Id ttk003000969.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14498, Molecular Weight 113946.90 Da.
    Residues 997 Isoelectric Point 6.48
    Sequence mlgllrrlfdnnereiaryykqvvepvnrleaeveklpdlaaayrelkekhekgasldellpmafaltr esakrylgmrhfdvqliggavlhegkiaemktgegktlvatlavalnaltgkgvhvvtvndylarrdae wmgpvyrglglsvgviqhastpaerrkayladvtyvtnselgfdylrdnmaispdqlvlrhdhplhyai idevdsilideartpliisgpaekatdlyykmaeiakklerglpaepgvrkeptgdytveeknrsvhlt lqgiakaekllgieglfspenmelahmliqairakelyhrdrdyivqdgqviivdeftgrlmpgrryge glhqaieakegvrierenqtlatityqnffrlyekragmtgtakteekefqeiygmdvvvvptnrpvir kdfpdvvyrtekgkfyavveeiaekyergqpvlvgtisiekserlsqmlkeprlylprlemrlelfkka sqkqqgpewerlrkllerpaqlkdedlapfeglippkgnlrtaweglkravhtlavlrqgiphqvlnak hhareaeivaqagrsktvtiatnmagrgtdiklggnpeylaaallekegfdryewkvelfikkmvagke eearalaqelgireellerireireeckqdeervralgglfiigterhesrridnqlrgragrqgdpgg srfyvsfdddlmrlfasdrviamldrmgfddsepiehpmvtrsieraqkrvedrnfairkqllqfddvl srqreviyaqrrlillgkdeevkeaaigmveetvaslaenflnpevhpedwdleglkatlldtapqlqd fpfaelralkaeeaverlveaalkayeareaelspplmraverfvilnvvdnawkehlhnldvlrqgif lrgygqkdpfqeykieatrlfnemvafiksevakflfrlkveaepvrpvreapyvpvpeakpepsevfg verkratpppqpglsraerrrlmrqekkrkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.80 Rfree 0.2545
    Matthews' coefficent 2.69 Rfactor 0.2213
    Waters 1370 Solvent Content 54.30

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch