.
The Open Protein Structure Annotation Network
PDB Keyword
.

2irp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the l-fuculose-1-phosphate aldolase (aq_1979) from aquifex aeolicus VF5. To be Published
    Site RSGI
    PDB Id 2irp Target Id aae001001979.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12087, Molecular Weight 23548.76 Da.
    Residues 208 Isoelectric Point 5.59
    Sequence mnvelfkkfsekveeiieagrilhsrgwvpatsgnisakvseeyiaitasgkhkgkltpedillidyeg rpvgggkpsaetllhttvyklfpevnavvhthspnatvisivekkdfveledyellkafpdihthevki kipifpneqnipllakevenyfktsedkygflirghglytwgrsmeealihtealefifecelkllsfhs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.252
    Matthews' coefficent 3.22 Rfactor 0.2
    Waters 340 Solvent Content 61.76

    Ligand Information
    Ligands BME (BETA-MERCAPTOETHANOL) x 2
    Metals CL (CHLORIDE) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch