The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the molybdopterin biosynthesis enzyme MoaB (TTHA0341) from thermus theromophilus HB8. To be Published
    Site RSGI
    PDB Id 2is8 Target Id ttk003000251.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14305, Molecular Weight 17847.79 Da.
    Residues 164 Isoelectric Point 9.15
    Sequence mfrvgiltvsdkgfrgerqdtthlairevlaggpfevaayelvpdeppmikkvlrlwadregldliltn ggtglaprdrtpeatrelldrevpglaelmrlvglrktpmaalsrgvagvrgrtlilnlpgspkgares leavlpvlphalslvtgkpwkeghhe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.64 Rfree 0.212
    Matthews' coefficent 1.91 Rfactor 0.185
    Waters 748 Solvent Content 35.56

    Ligand Information
    Ligands FMT (FORMIC) x 3



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch