.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ism

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Putative Oxidoreductase (Glucose Dehydrogenase) (TTHA0570) from Thermus Theromophilus HB8. To be Published
    Site RSGI
    PDB Id 2ism Target Id ttk003001311.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14681, Molecular Weight 38823.24 Da.
    Residues 352 Isoelectric Point 9.86
    Sequence mdrrrflvgllglglargqglrveevvgglevpwalaflpdggmliaerpgrirlfregrlstyaelsv yhrgesgllglalhprfpqepyvyayrtvaegglrnqvvrlrhlgergvldrvvldgiparphglhsgg riafgpdgmlyvttgevyerelaqdlaslggkilrltpegepapgnpflgrrgarpevyslghrnpqgl awhpktgelfssehgpsgeqgyghdevnlivpggnygwprvvgrgndpryrdplyfwpqgfppgnlaff rgdlyvaglrgqallrlvlegergrwrvlrvetalsgfgrlrevqvgpdgalyvttsnrdgrgqvrpgd drvlrll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.208
    Matthews' coefficent 1.90 Rfactor 0.181
    Waters 651 Solvent Content 35.30

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 2;CA (CALCIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch