The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of PH1069 protein from Pyrococcus horikoshii. To be Published
    Site RSGI
    PDB Id 2it3 Target Id pho001001069.3
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13970, Molecular Weight 23176.92 Da.
    Residues 200 Isoelectric Point 9.33
    Sequence mllymrftenferakkealmsleialrkgevdediipllkkinsienyfttsscsgrisvmemphfgdk vnakwlgkwhrevslyevleaikkhrsgqlwflvrspilhvgaktledavklvnlavscgfkysniksi snkkliveirstermdvllgengeifvgeeylnkiveiandqmrrfkeklkrleskinalnr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.27
    Matthews' coefficent 2.09 Rfactor 0.24
    Waters 258 Solvent Content 41.28

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch