The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Ternary Complex of Delta1-Pyrroline-5-Carboxylate Dehydrogenase with Substrate Mimic and Co-Factoer. To be Published
    Site RSGI
    PDB Id 2j40 Target Id ttk003000033.7
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14190, Molecular Weight 57043.17 Da.
    Residues 516 Isoelectric Point 5.57
    Sequence mtvepfrnepietfqteearramrealrrvreefgrhyplyiggewvdtkermvslnpsapsevvgtta kagkaeaeaaleaawkafktwkdwpqedrsrlllkaaalmrrrkreleatlvyevgknwveasadvaea idfieyyaraalryrypavevvpypgednesfyvplgagvviapwnfpvaiftgmivgpvavgntviak paedavvvgakvfeifheagfppgvvnflpgvgeevgaylvehprirfinftgslevglkiyeaagrla pgqtwfkrayvetggkdaiivdetadfdlaaegvvvsaygfqgqkcsaasrliltqgayepvlervlkr aerlsvgpaeenpdlgpvvsaeqerkvlsyieigknegqlvlggkrlegegyfiaptvftevppkaria qeeifgpvlsvirvkdfaealevandtpygltggvysrkrehlewarrefhvgnlyfnrkitgalvgvq pfggfklsgtnaktgaldylrlflemkavaerf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.189
    Matthews' coefficent 2.4 Rfactor 0.140
    Waters 788 Solvent Content 50

    Ligand Information
    Metals NA (SODIUM) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch