The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the Bromodomain-containing protein 4 ET domain. To be Published
    Site RSGI
    PDB Id 2jns Target Id ar_001000372.2
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS12152, Molecular Weight 9784.63 Da.
    Residues 83 Isoelectric Point 6.90
    Sequence eseeedkckpmsyeekrqlsldinklpgeklgrvvhiiqsrepslknsnpdeieidfetlkpstlrele ryvtsclrkkrkpq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch