The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for interaction of the ribosome with the switch regions of GTP-bound elongation factors. Mol.Cell 25 751-764 2007
    Site RSGI
    PDB Id 2om7 Target Id ttk003000863.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14459, Molecular Weight 76875.24 Da.
    Residues 691 Isoelectric Point 5.30
    Sequence mavkveydlkrlrnigiaahidagktttterilyytgrihkigevhegaatmdfmeqerergititaav ttcfwkdhriniidtpghvdftieversmrvldgaivvfdssqgvepqsetvwrqaekykvpriafank mdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipeeyld qareyheklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsalknkgvqllldav vdylpspldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvyntt kgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvgedaprvilesievpepvidvaie pktkadqeklsqalarlaeedptfrvsthpetgqtiisgmgelhleiivdrlkrefkvdanvgkpqvay retitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipkeyipavqkgieeamqs gpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqkgdpvilepimrvevttpeeymgdvi gdlnarrgqilgmeprgnaqvirafvplaemfgyatdlrsktqgrgsfvmffdhyqevpkqvqeklikgq
      BLAST   FFAS

    Structure Determination
    Method Chains 1
    Resolution (Å) 7.30 Rfree
    Matthews' coefficent Rfactor
    Waters Solvent Content

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch