.
The Open Protein Structure Annotation Network
PDB Keyword
.

2omd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of molybdopterin converting factor subunit 2 (aq_2181) from aquifex aeolicus VF5. To be Published
    Site RSGI
    PDB Id 2omd Target Id aae001002181.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12094, Molecular Weight 17578.44 Da.
    Residues 154 Isoelectric Point 5.89
    Sequence mevgmiprvylghewfgaerilseyqvpedcgaqvlflgiprnapedggniealeyeaypemaikemek irqetiekfgvkevfihhrlglvkigepsflvlavgghreetfkacryavdetkkrvpiwkkeifkegk gewvlgekknasgqtk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.215
    Matthews' coefficent 3.71 Rfactor 0.19
    Waters 379 Solvent Content 66.86

    Ligand Information
    Ligands TRS (2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL) x 1;FMT (FORMIC) x 2;GOL (GLYCEROL) x 2
    Metals NA (SODIUM) x 2;CL (CHLORIDE) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch