The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TTHB049 from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2owd Target Id ttk003000215.4
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14292, Molecular Weight 19619.44 Da.
    Residues 177 Isoelectric Point 6.44
    Sequence melwlvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdlmrarrtaelagfsprly pelreihfgalegalwetldprykeallrfqgfhppggeslsafqervfrfleglkapavlfthggvvr avlralgedglvppgsavavdwprrvlvrlaldgeeatg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.65 Rfree 0.218
    Matthews' coefficent 2.77 Rfactor 0.212
    Waters 389 Solvent Content 55.67

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals NA (SODIUM) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch