.
The Open Protein Structure Annotation Network
PDB Keyword
.

2owu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of PH0725 from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2owu Target Id pho001000725.30
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13880, Molecular Weight 29568.83 Da.
    Residues 265 Isoelectric Point 5.65
    Sequence mvlyfiglglyderditvkgleiakkcdyvfaefytslmagttlgriqkligkeirvlsredvelnfen ivlplakendvafltpgdplvatthaelrirakragvesyvihapsiysavgitglmiykfgksatvay pegnwfptsyydvikenaerglhtllfldikaekrmymtaneamelllkvedmkkggvftddtlvvvla ragslnptiragyvkdliredfgdpphilivpgklhiveaeylveiagapreilrvnv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.222
    Matthews' coefficent 3.27 Rfactor 0.204
    Waters 350 Solvent Content 62.34

    Ligand Information
    Ligands SAH (S-ADENOSYL-L-HOMOCYSTEINE) x 1
    Metals NA (SODIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch