The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of PH0725 from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2owv Target Id pho001000725.36
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13886, Molecular Weight 29542.80 Da.
    Residues 265 Isoelectric Point 5.76
    Sequence mvlyfiglglyderditvkgleiakkcdyvfaefytslmagttlgriqkligkeirvlsredvelnfen ivlplakendvafltpgdplvatthaelrirakragvesyvihapsiysavgitglhiykfgksatvay pegnwfptsmydvikenaerglhtllfldikaekrmymtaneamelllkvedmkkggvftddtlvvvla ragslnptiragyvkdliredfgdpphilivpgklhiveaeylveiagapreilrvnv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.252
    Matthews' coefficent 3.28 Rfactor 0.213
    Waters 121 Solvent Content 62.48

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch