.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p17

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of GK1651 from Geobacillus kaustophilus. To be Published
    Site RSGI
    PDB Id 2p17 Target Id gka001001651.1
    Molecular Characteristics
    Source Geobacillus kaustophilus
    Alias Ids TPS12303, Molecular Weight 31189.82 Da.
    Residues 279 Isoelectric Point 6.40
    Sequence ghmaiqrrirrvktvqmttnspihrsgsvlepgnwqeydpflllmedifergtfdvhphrgietvtyvi sgelehfdskaghstlgpgdvqwmtagrgvvhkedpasgstvhslqlwvnlpsaykmtepryqnlrskd mpvrkeegatirvfsgsskgvkaptknivpvtmvemivepgttvvqdlpghyngflyilegsgvfgadn iegkagqalffsrhnrgeetelnvtareklrlllyagepvnepvvaygpfvmntpeqireairdyqegrfgr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.52 Rfree 0.21313
    Matthews' coefficent 1.79 Rfactor 0.18841
    Waters 211 Solvent Content 31.40

    Ligand Information
    Ligands
    Metals FE (FE) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch