.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p5d

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of MJECL36 from Methanocaldococcus jannaschii DSM 2661. To be Published
    Site RSGI
    PDB Id 2p5d Target Id mja002000036.1
    Molecular Characteristics
    Source Methanocaldococcus jannaschii
    Alias Ids TPS13388, Molecular Weight 17541.84 Da.
    Residues 147 Isoelectric Point 9.65
    Sequence mdlmaywlcitnednwkvikekkiwgvaerykntinkvkvgdkliiyeiqrsgkdykppyirgvyevvs evykdsskifkptprnpnekfpyrvklkeikvfeppinfkelipklkfitnkkrwsghlmgkamreipe edyklivgn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.233
    Matthews' coefficent 2.05 Rfactor 0.216
    Waters 194 Solvent Content 39.88

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch