The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Thermus thermophilus HB8 UDP-glucose 4-epimerase complex with NAD. To be Published
    Site RSGI
    PDB Id 2p5u Target Id ttk003000522.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14404, Molecular Weight 33770.69 Da.
    Residues 311 Isoelectric Point 6.17
    Sequence mrvlvtggagfigshivedllarglevavldnlatgkrenvpkgvpffrvdlrdkegverafrefrpth vshqaaqasvkvsvedpvldfevnllgglnlleacrqygveklvfastggaiygevpegeraeetwppr pkspyaaskaafehylsvygqsyglkwvslrygnvygprqdphgeagvvaifaervlkglpvtlyarkt pgdegcvrdyvyvgdvaeahalalfslegiynvgtgeghttrevlmavaeaagkapevqpapprpgdle rsvlsplklmahgwrpkvgfqegirltvdhfrgav
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.37 Rfree 0.261
    Matthews' coefficent 4.06 Rfactor 0.235
    Waters 411 Solvent Content 69.73

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch