.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p5y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Thermus thermophilus HB8 UDP-glucose 4-epimerase complex with NAD. To be Published
    Site RSGI
    PDB Id 2p5y Target Id ttk003000522.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14405, Molecular Weight 33770.69 Da.
    Residues 311 Isoelectric Point 6.17
    Sequence mrvlvtggagfigshivedllarglevavldnlatgkrenvpkgvpffrvdlrdkegverafrefrpth vshqaaqasvkvsvedpvldfevnllgglnlleacrqygveklvfastggaiygevpegeraeetwppr pkspyaaskaafehylsvygqsyglkwvslrygnvygprqdphgeagvvaifaervlkglpvtlyarkt pgdegcvrdyvyvgdvaeahalalfslegiynvgtgeghttrevlmavaeaagkapevqpapprpgdle rsvlsplklmahgwrpkvgfqegirltvdhfrgav
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.92 Rfree 0.207
    Matthews' coefficent 3.07 Rfactor 0.191
    Waters 217 Solvent Content 60.00

    Ligand Information
    Ligands NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch