The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein PH0156 from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2p62 Target Id pho001000156.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13791, Molecular Weight 27590.93 Da.
    Residues 241 Isoelectric Point 6.48
    Sequence mrikliivegktdesffkvlleklygfreakkltpefpigkwgfrigehplvlekdnialviihaegkq ripkvlksvldsvklgllnveevyvvrdvdegndvfewvlsflrerevrvdngaivtegvkiypygmgn ltlnepfvkekkelelslaylakldgilekyrgsmralsqdkgdkltpkdvmhilsiandytgdclsgl yekyigimihrnrellirflsevnllpllermvg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.244
    Matthews' coefficent 4.24 Rfactor 0.213
    Waters 131 Solvent Content 71.01

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch