.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p6c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein aq_2013 from Aquifex aeolicus VF5. To be Published
    Site RSGI
    PDB Id 2p6c Target Id aae001002013.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12090, Molecular Weight 15985.49 Da.
    Residues 137 Isoelectric Point 5.88
    Sequence mkaytkyltfntkkrreliritdevkkaveesevkeglclvssmhltssviiqddeeglhediwewlek lapyrpdykhhrtgedngdahlknllthlqvvlpitngkldlgpwqeifyaefdgqrpkrvvikiige
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.200
    Matthews' coefficent 1.99 Rfactor 0.183
    Waters 251 Solvent Content 38.05

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 6
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch