.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p8t

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Hypothetical protein PH0730 from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2p8t Target Id pho001000730.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13938, Molecular Weight 22627.34 Da.
    Residues 200 Isoelectric Point 6.87
    Sequence mvgqvirkrgaypeytvedvlavifllkeplgrkqiserlelgegsvrtllrklshldiirskqrghfl tlkgkeirdkllsmfsepigvsvdgypgiaivvknppefksielrdeaikfdakgamiltvkdneivfp edfrplkemypevakkivdyedgdaviitwaetpakalksaihvayilkkeeitpeilevvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.279
    Matthews' coefficent 1.97 Rfactor 0.227
    Waters 117 Solvent Content 37.57

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch