.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p9j

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of AQ2171 from Aquifex aeolicus. To be Published
    Site RSGI
    PDB Id 2p9j Target Id aae001002171.2
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12092, Molecular Weight 18355.55 Da.
    Residues 163 Isoelectric Point 6.20
    Sequence malrdrvkklkllimdidgvltdgklyytehgetikvfnvldgigikllqkmgitlavisgrdsaplit rlkelgveeiytgsykkleiyekikekyslkdeeigfigddvvdievmkkvgfpvavrnaveevrkvav yitqrnggegalrevaelihflknd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.26771
    Matthews' coefficent 2.17 Rfactor 0.21639
    Waters 218 Solvent Content 43.39

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch