The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of conserved hypothetical protein MJ0922 from Methanocaldococcus jannaschii DSM 2661. To be Published
    Site RSGI
    PDB Id 2p9m Target Id mja001000922.1
    Molecular Characteristics
    Source Methanocaldococcus jannaschii
    Alias Ids TPS13375, Molecular Weight 15468.35 Da.
    Residues 138 Isoelectric Point 6.13
    Sequence midtlknikvkdvmtknvitakrhegvveafekmlkykisslpviddenkvigivtttdigynlirdky tlettigdvmtkdvitihedasileaikkmdisgkkeeiinqlpvvdknnklvgiisdgdiirtiskii
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.59 Rfree 0.29177
    Matthews' coefficent 2.23 Rfactor 0.22193
    Waters 22 Solvent Content 46.00

    Ligand Information



    Protein Summary

    Please see 1vr9 entry.


    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch