The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TTHB049 from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2p9z Target Id ttk003000215.17
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14283, Molecular Weight 19575.37 Da.
    Residues 177 Isoelectric Point 6.53
    Sequence melwlvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdllrarrtaelagfsprlh pelreihfgalegalwetldprykeallrfqgfhppggeslsafqervfrfleglkapavlfthggvvr avlralgedglvppgsavavdwprrvlvrlaldgeeatg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.216
    Matthews' coefficent 2.75 Rfactor 0.204
    Waters 370 Solvent Content 55.21

    Ligand Information
    Ligands GOL (GLYCEROL) x 4
    Metals NA (SODIUM) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch