.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pa2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Human Ribosomal Protein L10 Core Domain Reveals Eukaryote-Specific Motifs in Addition to the Conserved Fold. J.Mol.Biol. 377 421-430 2008
    Site RSGI
    PDB Id 2pa2 Target Id hss001002628.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13300, Molecular Weight 17015.04 Da.
    Residues 149 Isoelectric Point 9.93
    Sequence fdlgrkkakvdefplcghmvsdeyeqlssealeaaricankymvkscgkdgfhirvrlhpfhvirinkm lscagadrlqtgmrgafgkpqgtvarvhigqvimsirtklqnkehviealrrakfkfpgrqkihiskkw gftkfnadefe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.264
    Matthews' coefficent 2.16 Rfactor 0.24
    Waters 35 Solvent Content 43.15

    Ligand Information
    Ligands
    Metals K (POTASSIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch