.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pbp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ENOYL-CoA hydrates subunit I (gk_2039) from geobacillus kaustophilus HTA426. To be Published
    Site RSGI
    PDB Id 2pbp Target Id gka001002039.1
    Molecular Characteristics
    Source Geobacillus kaustophilus
    Alias Ids TPS12309, Molecular Weight 28585.61 Da.
    Residues 260 Isoelectric Point 5.74
    Sequence ghmsefvsiaarqegavgiielarpdvlnalsrqmvaeivaaveafdrnekvrvivltgrgrafaagad iqemakddpirlewlnqfadwdrlsivktpmiaavnglalgggfelalscdlivassaaefgfpevnlg vmpgaggtqrltkligpkralewlwtgarmsakeaeqlgivnrvvspellmeetmrlagrlaeqpplal rlikeavqkavdyplyegmqferknfyllfasedqkegmaaflekrkprfqgk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.207
    Matthews' coefficent 2.00 Rfactor 0.174
    Waters 359 Solvent Content 38.46

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch