.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pbr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of thymidylate kinase (aq_969) from Aquifex Aeolicus VF5. To be Published
    Site RSGI
    PDB Id 2pbr Target Id aae001000969.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12050, Molecular Weight 22368.77 Da.
    Residues 195 Isoelectric Point 5.28
    Sequence mliafegidgsgkttqakklyeylkqkgyfvslyrepggtkvgevlreillteeldertelllfeasrs klieekiipdlkrdkvvildrfvlstiayqgygkgldvefiknlnefatrgvkpditllldipvdialr rlkeknrfenkeflekvrkgflelakeeenvvvidasgeeeevfkeilralsgvlrv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.96 Rfree 0.242
    Matthews' coefficent 2.35 Rfactor 0.194
    Waters 320 Solvent Content 47.70

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch