.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pcj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ABC transporter (aq_297) From Aquifex Aeolicus VF5. To be Published
    Site RSGI
    PDB Id 2pcj Target Id aae001000297.2
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12032, Molecular Weight 24885.69 Da.
    Residues 224 Isoelectric Point 7.83
    Sequence maeilraenikkvirgyeilkgislsvkkgefvsiigasgsgkstllyilglldaptegkvflegkevd ytnekelsllrnrklgfvfqfhylipeltalenvivpmlkmgkpkkeakergeyllselglgdklsrkp yelsggeqqrvaiaralanepillfadeptgnldsantkrvmdiflkineggtsivmvtherelaelth rtlemkdgkvvgeitrv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.208
    Matthews' coefficent 2.08 Rfactor 0.18
    Waters 452 Solvent Content 40.87

    Ligand Information
    Ligands SO3 (SULFITE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch