The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of S-adenosylmethionine:2-dimethylmenaquinone methyltransferase (gk_1813) from geobacillus kaustophilus HTA426. To be Published
    Site RSGI
    PDB Id 2pcn Target Id gka001001813.2
    Molecular Characteristics
    Source Geobacillus kaustophilus
    Alias Ids TPS12304, Molecular Weight 19469.24 Da.
    Residues 182 Isoelectric Point 5.87
    Sequence mgsshhhhhhssgenlyfqghmktadlcdqfldelqvcelpfqsyggkrmfsgpiatvdvfednvlvre aletvppgtvlvvdgkgsrrvallgdrlaqiacerglagviihgcirdsaeigampigvmaigtcpvks kkegkgardvvlefggvrwepgayvyadadgvvvankdllakng
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.205
    Matthews' coefficent 3.36 Rfactor 0.176
    Waters 258 Solvent Content 63.35

    Ligand Information
    Ligands ACT (ACETATE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch