.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pcq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative dihidrodipicolinate synthase (TTHA0737) from Thermus Thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2pcq Target Id ttk003000287.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14320, Molecular Weight 30967.13 Da.
    Residues 283 Isoelectric Point 6.02
    Sequence milppiptpfdregrldeeafrelaqaleplvdgllvygsngegvhltpeerarglralrprkpflvgl meetlpqaegalleakaagamallatppryyhgslgagllryyealaekmplflyhvpqntkvdlplea vealaphpnvlgikdssgdlsriafyqarlqefrvytghaptflgalalgaeggilaaanlaprayral ldhfregrlaeaqelqkklfplgdllakggvpllkqalrhlglpagyprppypaesplwerflpvlegl keegwvl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.193
    Matthews' coefficent 4.28 Rfactor 0.164
    Waters 440 Solvent Content 71.23

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals K (POTASSIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch