.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pd2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of (ST0148) conserved hypothetical from Sulfolobus Tokodaii Strain7. To be Published
    Site RSGI
    PDB Id 2pd2 Target Id sto001000148.2
    Molecular Characteristics
    Source Sulfolobus tokodaii
    Alias Ids TPS14033, Molecular Weight 12093.47 Da.
    Residues 108 Isoelectric Point 6.72
    Sequence mkvvvqikdfdkvpqalrsvinlyndikdaeievvlhqsaikallkdsdtrsiiedlikknilivgcen sirsqnlshdqlipgikivtsgvgeivrkqsegwiylal
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.06 Rfree 0.236
    Matthews' coefficent 2.43 Rfactor 0.186
    Waters 152 Solvent Content 49.47

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch