The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of 3-oxoacyl-[acyl carrier protein] reductase TTHA0415 from Thermus thermophilus. To be Published
    Site RSGI
    PDB Id 2ph3 Target Id ttk003000139.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14245, Molecular Weight 26209.67 Da.
    Residues 245 Isoelectric Point 6.87
    Sequence mrkalitgasrgigraialrlaedgfalaihygqnrekaeevaeearrrgsplvavlganlleaeaata lvhqaaevlggldtlvnnagitrdtllvrmkdedweavleanlsavfrttreavklmmkarfgrivnit svvgilgnpgqanyvaskagligftravakeyaqrgitvnavapgfietemterlpqevkeaylkqipa grfgrpeevaeavaflvsekagyitgqtlcvdggltph
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.91 Rfree 0.229
    Matthews' coefficent 2.21 Rfactor 0.189
    Waters 188 Solvent Content 44.46

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch