.
The Open Protein Structure Annotation Network
PDB Keyword
.

2phc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of conserved uncharacterized protein PH0987 from Pyrococcus horikoshii. To be Published
    Site RSGI
    PDB Id 2phc Target Id pho001000987.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13958, Molecular Weight 25294.68 Da.
    Residues 225 Isoelectric Point 5.04
    Sequence miikpagdsaflisfgdeiseeindrvhslakaiekespewlvelvpayssllviydplkasyeevesy lkrisareverikgktieipvayggefgpdiefvaqynglsvddvieihskplyrvyflgflpgfaylg gmderiatprlekprlkvpagsvgiagkqtgwyaiespggwriigriplrtfnpgkvppsivlpgdyvk fvpidekefweiygrewe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.29 Rfree 0.294
    Matthews' coefficent 3.31 Rfactor 0.239
    Waters 91 Solvent Content 62.84

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch