.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pib

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative beta-phosphoglucomutase from Thermotoga maritima. To be Published
    Site RSGI
    PDB Id 2pib Target Id tma001001254.1
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS14081, Molecular Weight 24627.29 Da.
    Residues 216 Isoelectric Point 5.37
    Sequence meavifdmdgvlmdteplyfeayrrvaesygkpytedlhrrimgvpereglpilmealeikdslenfkk rvheekkrvfsellkenpgvrealefvkskriklalatstpqrealerlrrldlekyfdvmvfgdqvkn gkpdpeiyllvlerlnvvpekvvvfedsksgveaaksagieriygvvhslndgkalleagavalvkpee ilnvlkevl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.73 Rfree 0.21942
    Matthews' coefficent 2.70 Rfactor 0.17899
    Waters 500 Solvent Content 54.41

    Ligand Information
    Ligands SO4 (SULFATE) x 6;GOL (GLYCEROL) x 5
    Metals NA (SODIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch