.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pjz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of putative Cobalt transport ATP-binding protein (cbiO-2), ST1066. To be Published
    Site RSGI
    PDB Id 2pjz Target Id sto001001066.1
    Molecular Characteristics
    Source Sulfolobus tokodaii
    Alias Ids TPS14047, Molecular Weight 29359.56 Da.
    Residues 263 Isoelectric Point 6.78
    Sequence miqlknvgitlsgkgyerfsleninlevngekviilgpngsgkttllraisgllpysgnifingmevrk irnyirystnlpeayeigvtvndivylyeelkgldrdlflemlkalklgeeilrrklyklsagqsvlvr tslalasqpeivgldepfenvdaarrhvisryikeygkegilvtheldmlnlykeykayflvgnrlqgp isvsellessivegerndallvldimdkkvsivkgdlgmkfgalgslnriygiiga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.24172
    Matthews' coefficent 2.68 Rfactor 0.19586
    Waters 208 Solvent Content 54.06

    Ligand Information
    Ligands SO4 (SULFATE) x 5
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch