.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pkp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Substrate specificity determinants of the methanogen homoaconitase enzyme: structure and function of the small subunit. Biochemistry 49 2687-2696 2010
    Site RSGI
    PDB Id 2pkp Target Id mja001001271.1
    Molecular Characteristics
    Source Methanocaldococcus jannaschii
    Alias Ids TPS13380, Molecular Weight 18663.67 Da.
    Residues 170 Isoelectric Point 8.58
    Sequence miikgrahkfgddvdtdaiipgpylrttdpyelashcmagidenfpkkvkegdvivagenfgcgssreq aviaikycgikaviaksfarifyrnainvglipiiantdeikdgdiveidldkeeivitnknktikcet pkglereilaagglvnylkkrkliqskkgvkt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.248
    Matthews' coefficent 2.99 Rfactor 0.201
    Waters 149 Solvent Content 58.91

    Ligand Information
    Ligands PEG (DI(HYDROXYETHYL)ETHER) x 1
    Metals ZN (ZINC) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch