The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of dTMP kinase (st1543) from Sulfolobus Tokodaii Strain7. To be Published
    Site RSGI
    PDB Id 2plr Target Id sto001001543.1
    Molecular Characteristics
    Source Sulfolobus tokodaii
    Alias Ids TPS14053, Molecular Weight 24594.13 Da.
    Residues 213 Isoelectric Point 8.50
    Sequence mkkgvliafegidgsgkssqatllkdwielkrdvyltewnssdwihdiikeakkkdlltpltfslihat dfsdryeryilpmlksgfivisdryiytayardsvrgvdidwvkklysfaikpditfyirvspdialer ikkskrkikpqeagadifpglspeegflkyqglitevydklvkdenfividgtktpkeiqiqirkfvge lidnsf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.209
    Matthews' coefficent 2.16 Rfactor 0.185
    Waters 521 Solvent Content 43.10

    Ligand Information
    Metals CL (CHLORIDE) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch