The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Enoyl-CoA hydrates (gk_1992) from Geobacillus Kaustophilus HTA426. To be Published
    Site RSGI
    PDB Id 2ppy Target Id gka001001992.1
    Molecular Characteristics
    Source Geobacillus kaustophilus
    Alias Ids TPS12307, Molecular Weight 29747.46 Da.
    Residues 267 Isoelectric Point 5.72
    Sequence ghmtavetkkqyltvfkedgiaeihlhinksnsydlefykefnaaiddirfdpdikvvivmsdvpkffs agadinflrsadprfktqfclfcnetldkiarspqvyiacleghtvggglemalacdlrfmgdeagkig lpevslgvlagtggtqrlarligysraldmnitgetitpqealeiglvnrvfpqaetrertreyarkla nsatyavsniklaimngkemplnvairyegelqnllfrsedakeglsaflekrqpnwkgi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.16 Rfree 0.219
    Matthews' coefficent 2.06 Rfactor 0.176
    Waters 1098 Solvent Content 40.34

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch