.
The Open Protein Structure Annotation Network
PDB Keyword
.

2psm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Interleukin-15{middle dot}Interleukin-15 Receptor {alpha} Complex: INSIGHTS INTO TRANS AND CIS PRESENTATION. J.Biol.Chem. 282 37191-37204 2007
    Site RSGI
    PDB Id 2psm Target Id ar_001000558.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS12189, Molecular Weight 13250.32 Da.
    Residues 114 Isoelectric Point 4.60
    Sequence nwidvrydlekiesliqsihidttlytdsdfhpsckvtamncfllelqvilheysnmtlnetvrnvlyl anstlssnknvaesgckeceeleektfteflqsfirivqmfints
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.19 Rfree 0.236
    Matthews' coefficent 3.01 Rfactor 0.224
    Waters 91 Solvent Content 59.16

    Ligand Information
    Ligands BAM (BENZAMIDINE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch