.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pt5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure Of Shikimate Kinase (aq_2177) From Aquifex Aeolicus vf5. To be Published
    Site RSGI
    PDB Id 2pt5 Target Id aae001002177.2
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12093, Molecular Weight 19079.07 Da.
    Residues 168 Isoelectric Point 5.80
    Sequence mriyligfmcsgkstvgsllsrslnipfydvdeevqkreglsipqifekkgeayfrklefevlkdlsek envvistggglganeealnfmksrgttvfidipfevflerckdskerpllkrpldeiknlfeerrkiys kadikvkgekppeevvkeillslegnalgg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.269
    Matthews' coefficent 1.89 Rfactor 0.214
    Waters 262 Solvent Content 34.77

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1;PEG (DI(HYDROXYETHYL)ETHER) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch