The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Iron-sulfur cluster biosynthesis protein IscU (TTHA1736) from thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2qq4 Target Id ttk003000231.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14301, Molecular Weight 14778.27 Da.
    Residues 138 Isoelectric Point 5.14
    Sequence msvldelyreilldhyqsprnfgvlpqatkqaggmnpscgdqvevmvllegdtiadirfqgqgcaista saslmteavkgkkvaealelsrkfqamvvegappdptlgdllalqgvaklparvkcatlawhaleealr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 10
    Resolution (Å) 1.85 Rfree 0.26
    Matthews' coefficent 2.29 Rfactor 0.225
    Waters 766 Solvent Content 46.21

    Ligand Information
    Metals ZN (ZINC) x 10



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch