.
The Open Protein Structure Annotation Network
PDB Keyword
.

2r1c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural aspects of RbfA action during small ribosomal subunit assembly. Mol.Cell 28 434-445 2007
    Site RSGI
    PDB Id 2r1c Target Id ttk003000788.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14437, Molecular Weight 10856.06 Da.
    Residues 95 Isoelectric Point 10.42
    Sequence maygkahleaqlkralaeeiqaledprlflltveavrlskdgsvlsvyveafreeegalralsraerrl vaalarrvrmrrlprleflpwraspa
      BLAST   FFAS

    Structure Determination
    Method Chains 1
    Resolution (Å) 12.50 Rfree
    Matthews' coefficent Rfactor
    Waters Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch