.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rbg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein(ST0493) from sulfolobus tokodaii. To be Published
    Site RSGI
    PDB Id 2rbg Target Id sto001000493.1
    Molecular Characteristics
    Source Sulfolobus tokodaii
    Alias Ids TPS14035, Molecular Weight 14849.44 Da.
    Residues 126 Isoelectric Point 5.54
    Sequence mpykniltlisvnndnfenyfrkifldvrssgskkttinvfteiqyqelvtlireallenidigyelfl wkknevdiflknleksevdgllvycddenkvfmskivdnlptaikrnlikdfcrkls
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.75 Rfree 0.196
    Matthews' coefficent 2.11 Rfactor 0.173
    Waters 316 Solvent Content 41.69

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch